If you have been reading about Freeze-thaw cycle and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-03-30. Where a claim depends on a specific study, the study is described rather than over-claimed.
Aseptic technique matters because aqueous peptide solutions can support microbial growth. Sterile solvents, clean workspaces, and sterile filtration can reduce contamination. The choice of filter material and pore size must avoid peptide loss through adsorption, especially for hydrophobic or low-concentration samples. Visual inspection for particles, turbidity, or color change provides a simple initial check, but it cannot confirm identity or purity. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to verify composition and detect degradation products.
Documentation supports reproducibility and traceability. Records often include lot number, solvent composition, final concentration, preparation date, and storage location. Such details help distinguish procedural variation from actual sample instability. Questions remain about how best to predict long-term stability from short-term accelerated studies, because peptide degradation pathways differ widely. For many peptides, the relationship between in vitro solution stability and biological behavior is incompletely understood and is an active area of research.
After reconstitution, a peptide solution is typically stored under conditions that limit degradation. Cool temperatures slow hydrolysis and oxidation, while freezing can preserve samples for longer periods. Repeated freeze-thaw cycles may promote aggregation or precipitation, so aliquoting before freezing is a common laboratory practice. The optimal storage temperature depends on the peptide sequence, buffer composition, and expected duration. Solutions containing oxidizable residues may benefit from inert gas overlays or antioxidants, though compatibility with the specific peptide must be considered.
Storage recommendations for reconstituted peptides vary by sequence and intended use, so general rules remain broad. A common laboratory practice is to keep solutions cold, sometimes frozen, and protected from light, but freezing itself can damage certain peptides. The pH of the solution may be adjusted to a range where the peptide is most stable, though changing pH can also alter solubility. Documentation of reconstitution date, solvent, concentration, and storage conditions supports reproducibility. Stability data for a specific peptide are generally established by direct measurement rather than assumed from related compounds.
Once a peptide is in solution, its stability depends on temperature, pH, ionic strength, and the presence of oxygen or light. Many peptides are less stable in liquid form than as dry powders because hydrolysis, oxidation, and aggregation can proceed faster in water. Storage at low temperature slows these reactions but does not eliminate them. Some sequences are particularly sensitive to repeated freezing and thawing, which can cause precipitation or conformational changes. The container material and headspace also influence adsorption and surface-induced aggregation.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature (lyophilized) | -20 °C or lower | Desiccant and sealed container limit moisture |
| Typical storage temperature (reconstituted) | 2-8 °C short term; frozen for longer | Freeze-thaw cycles may damage peptide |
| Appearance of solution | Clear to slightly opalescent | Turbidity or particles suggest aggregation or contamination |
| Identity method | Mass spectrometry | Confirms molecular mass and detects modifications |
| Purity method | Reversed-phase HPLC | Separates peptide from related impurities |
During reconstitution, liquid is directed toward the wall of the vial rather than forcefully onto the powder. Gentle swirling or inversion mixes the contents without creating excessive foam or shear. Foaming can denature some peptides and can make volume measurement difficult. Complete dissolution is often confirmed by visual inspection against a light source. Particles, cloudiness, or undissolved material may indicate incomplete mixing, aggregation, or a solubility limitation that requires further investigation.
Peptide reconstitution is the addition of a liquid to a dried peptide preparation so that the peptide dissolves and forms a solution. Many research peptides are supplied as lyophilized powders, a form produced by freezing and then removing solvent under vacuum. The dried material often appears as a cake or fluffy powder. Dissolution depends on the peptide's sequence, charge, and hydrophobicity. Not all peptides dissolve equally in the same liquid.
Reconstitution involves considerably more than simply adding liquid. The solid must wet completely, and gentle mixing should avoid foaming, which can denature some peptides. Insoluble particles may indicate incomplete dissolution, aggregation, or insoluble excipients. The resulting concentration is calculated from the weighed peptide mass and the final volume, not from the volume of liquid added alone. Because peptides can adsorb to surfaces, container material and transfer steps can influence recovery, especially at low concentrations.
Peptide reconstitution refers to dissolving a dried peptide preparation in a liquid to form a solution. The dried form is often produced by lyophilization, a process that removes water under vacuum from a frozen sample. This yields a porous cake or powder that is more stable for transport and storage than many liquid formulations. The term reconstitution is also often used for other dried biological materials, so context matters greatly.
The choice of liquid depends on peptide sequence, counterion content, and intended analysis. Water is sufficient for many hydrophilic peptides, while hydrophobic sequences may need a small amount of organic solvent or a buffer. pH can affect charge, solubility, and stability, so the target value is usually selected for the specific peptide. Exact laboratory protocols vary by supplier and application, and no single solvent reliably works for every different peptide.
AAA (ATPases Associated with diverse cellular Activities) proteins (more commonly referred to as "triple-A ATPases") are a large group of protein family sharing a common conserved module of approximately 230 amino acid residues. This is a large, functionally diverse protein family belonging to the AAA+ protein superfamily of ring-shaped P-loop NTPases, which exert their activity through the energy-dependent remodeling or translocation of macromolecules. AAA proteins couple chemical energy provided by ATP hydrolysis to conformational changes which are transduced into mechanical force exerted on a macromolecular substrate. AAA proteins are functionally and organizationally diverse, and vary in activity, stability, and mechanism. Members of the AAA family are found in all organisms and they are essential for many cellular functions. They are involved in processes such as DNA replication, protein degradation, membrane fusion, microtubule severing, peroxisome biogenesis, signal transduction and the regulation of gene expression.
Mouse MA-10 cells respond to 5-oxo-ETE but lack OXER1. It has been suggested that these cells' responses to 5-oxo-ETE are mediated by an ortholog to OXER1, mouse niacin receptor 1, Niacr1, which is a G protein-coupled receptor for niacin, or, alternatively, by one or more of the mouse hydroxycarboxylic acid (HCA) family of the G protein-coupled receptors, HCA1 (GPR81), HCA2 (GPR109A), and HCA3 (GPR109B), which are G protein-coupled receptors for fatty acids.
In 2001, Nakai et al. reported the development of GCaMP1 as a Ca2+ probe with improved signal-to-noise ratio compared to previously developed fluorescent Ca2+ probes. The first transgenic mouse expressing GCaMP1 was reported in 2004. However, at 37 ˚C (physiological temperature in mammals), GCaMP1 did not fold stably or fluoresce, limiting its potential use as a calcium indicator in vivo. In 2006, Tallini et al. subsequently reported the improvement of GCaMP1 to GCaMP2, which exhibited brighter fluorescence than GCaMP1 and greater stability at mammalian body temperatures. Tallini et al. expressed GCaMP2 in cardiomyocytes in mouse embryos to perform the first in vivo GCaMP imaging of Ca2+ in mammals. Further modifications of GCaMP, including GCaMP3, GCaMP5, GCaMP6, and jGCaMP7, have been developed to progressively improve the signal, sensitivity, and dynamic range of Ca2+ detection, with recent versions exhibiting fluorescence similar to native GFP.
3-M syndrome or 3M3 is a rare hereditary disorder characterized by severe growth retardation, facial dysmorphia, and skeletal abnormalities. The name 3-M is derived from the initials of the three researchers who first identified it: Miller, McKusick, and Malvaux; they reported their findings in the medical literature in 1972. Mutations in any one of the following three genes: CUL7, OBSL1, and CCDC8 are responsible for the occurrence of this disorder. It is inherited through an autosomal recessive pattern and considered very rare, so far less than 100 cases worldwide have been identified. Diagnosis is based on the presence of clinical features. Genetic testing can confirm the diagnosis and identify the specific gene involved. Treatment is aimed at addressing the growth and skeletal problems and may include surgical bone lengthening, adaptive aids, and physical therapy. An endocrinologist may assist with growth hormone replacement and appropriate evaluations during puberty.
G-protein-coupled receptor oligomerisation is a widespread phenomenon. One of the best-studied examples is the metabotropic GABAB receptor. This so-called constitutive receptor is formed by heterodimerization of GABABR1 and GABABR2 subunits. Expression of the GABABR1 without the GABABR2 in heterologous systems leads to retention of the subunit in the endoplasmic reticulum. Expression of the GABABR2 subunit alone, meanwhile, leads to surface expression of the subunit, although with no functional activity (i.e., the receptor does not bind agonist and cannot initiate a response following exposure to agonist). Expression of the two subunits together leads to plasma membrane expression of functional receptor. It has been shown that GABABR2 binding to GABABR1 causes masking of a retention signal of functional receptors.
Sources: en.wikipedia.org
The adipokines, or adipocytokines (Greek adipo-, fat; cytos-, cell; and -kinos, movement) are cytokines (cell signaling proteins) secreted by adipose tissue. Some contribute to an obesity-related low-grade state of inflammation or to the development of metabolic syndrome, a constellation of diseases including, but not limited to, type 2 diabetes, cardiovascular disease and atherosclerosis. The first adipokine to be discovered was leptin in 1994. Since that time, hundreds of adipokines have been discovered. Members include: Leptin Adiponectin Apelin chemerin interleukin-6 (IL-6) monocyte chemotactic protein-1 (MCP-1) plasminogen activator inhibitor-1 (PAI-1) retinol binding protein 4 (RBP4) tumor necrosis factor visfatin omentin vaspin (SERPINA12) progranulin CTRP-4 Interleukin 8 (IL-8), interleukin 10 (IL-10), interferon gamma (IFN-γ) and inducible protein 10 (IP-10 or CXCL10) have been shown to be associated with excessive body weight. Adipose tissue Hepatokines Myokines Adipokines at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
No paralogs of c7orf26 have been found in the human genome, however, six unique isoforms have been identified. They are c7orf26 isoform (X1, X2, X3, X4) and isoform 2 (two sub-isoforms identified). Below is a table of a variety of orthologs of the human c7orf26. The table include closely, intermediately and distantly related orthologs. Orthologs of the human protein c7orf26 are listed above in descending order of the date of divergence. c7orf26 is highly conserved throughout all orthologs, this is demonstrated with a 65% identity in the least similar ortholog. c7orf26 has evolved slowly and evenly over time. Below is a phylogenetic tree showing the evolutionary history of c7orf26 and its nearest orthologs.
The method numbers generally range from 1 to 9000 and may have modification letters appended to the end, signifying a newer version of the method has been released. Some ranges of numbers appear to be organized with intention, for example methods 1-99 being air methods or the 7000s being for hazardous waste. Others number ranges, however, seem to only contain random methods, like the 300 and 400 series both being for wet chemistry methods. EPA methods are listed by category on the EPA website. The US government keeps a collection of environmental testing methods at the National Environmental Methods Index website which includes EPA methods along with methods from other agencies like the USGS. Analytical chemistry EPA Hazardous Waste Test Methods EPA Air Emission Methods with Links Clean Water Act Analytical Methods Drinking Water Analytical Methods
Closer Roberto Osuna converted his 25th consecutive save on May 24, breaking a club record. The streak had started the previous August 18, surpassing Brad Lidge (24 consecutive from June 21–September 28, 2005). Osuna's feat remained the franchise longest until Josh Hader converted 29 consecutive from April 7 to August 29, 2024. On May 28, A. J. Hinch obtained his 500th win as manager, as the Astros toppled the Chicago Cubs, 9–6. Chicago blasted five home runs, but Houston answered with five doubles—two by Jake Marisnick (8)—and two home runs by Alex Bregman (17). Bregman collected three RBI, and Michael Brantley had two hits and two RBI as Houston scored four times in the bottom of the fourth. Josh James (2–0) picked up the victory in relief while surrendering three runs over 2+1⁄3 frames. With injuries stacking up, on May 29 shortstop Carlos Correa sustained a bruised rib during a massage session. He was forced to join fellow All-Stars Springer and Jose Altuve on the injured list (IL) and expected to miss four to six weeks.
In the evening hours of 24 June 2021, a rare, violent, and deadly long-tracked tornado struck several villages in the Hodonín and Břeclav districts of the South Moravian Region of the Czech Republic, killing six people and injuring 576 others. This tornado is the widest on record in Europe, at 3.5 kilometres (2.2 mi) maximum width. The tornado struck seven municipalities, with the worst damage in the villages of Hrušky, Moravská Nová Ves, Mikulčice and Lužice. This tornado was the strongest ever documented in modern Czech history and the deadliest European tornado since 2001. It was rated as an F4 on the Fujita scale and an IF4 on the International Fujita scale. This made it the first confirmed violent (IF4+) tornado in Europe since June 2017, when an IF4 tornado struck the village of Maloye Pes'yanovo in Russia, until the 2026 Ayyasha-Çaybeyi-Akçamezra tornado on May 3rd 2026, it was the only IF4 rated tornado to occur since the scale was introduced.
Sources: en.wikipedia.org
ABS-201 is an AI-designed monoclonal antibody against the prolactin receptor (PRLR) currently in Phase 1/2a clinical trial for the treatment of androgenic alopecia (pattern hair loss) and endometriosis. It is taken by subcutaneous injection. ABS-201 is a possible first-in-class drug with a novel mechanism of action in the potential treatment of hair loss. ABS-201 is under development by Absci. It is believed that ABS-201 works by activating dormant hair follicles and causing them to move from the telogen phase to the anagen phase. In human ex vivo scalp model studies, ABS-201 stimulated hair regrowth, prolonged anagen phase, blocked catagen phase, inhibited telogen effluvium, and blocked hair from losing color. ABS-201 has been found to produce robust hair regrowth as compared with minoxidil in mice and balding macaques. The clinical trial for ABS-201 is being overseen by prominent hair loss researcher Rodney Sinclair, one of the principal investigators in minoxidil clinical trials. The chemical structure of the drug does not yet appear to have been disclosed.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The alpha-1B adrenergic receptor (α1B-adrenoreceptor), also known as ADRA1B, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. The crystal structure of the α1B-adrenergic receptor has been determined in complex with the inverse agonist (+)-cyclazosin. There are 3 alpha-1 adrenergic receptor subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. They activate mitogenic responses and regulate growth and proliferation of many cells. This gene encodes alpha-1B-adrenergic receptor, which induces neoplastic transformation when transfected into NIH 3T3 fibroblasts and other cell lines. Thus, this normal cellular gene is identified as a protooncogene. This gene comprises 2 exons and a single large intron of at least 20 kb that interrupts the coding region. Antagonists L-765,314 Risperidone Brexpiprazole Tamsulosin Alpha-1B adrenergic receptor has been shown to interact with AP2M1. A role in regulation of dopaminergic neurotransmission has also been suggested.
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to IFN, this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (IRF9) and form ISGF-3 (IFN-stimulated gene factor-3), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44. ISGF-3 proceeds the activation of genes via the IFN-stimulated response element (ISRE). ISRE-driven genes include Ly-6C, the double-stranded RNA kinase (PKR), 2´ to 5´ oligoadenylate synthase (OAS), MX and potentially MHC class I. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. STAT2 knockout mice are unresponsive to type I IFN and extremely vulnerable to viral infection. They indicate the loss of the type I IFN autocrine loop and several defects in macrophages and T cell responses. Stat2-/- cells show differences in the biological response to IFN-α.
Sources: en.wikipedia.org
Short-term storage is often at refrigerated temperatures, while longer storage may use freezing. Repeated freeze-thaw cycles are generally avoided because they can promote aggregation. Container material and headspace can also affect stability.
Mass spectrometry is commonly used to confirm molecular mass and detect modifications. Reversed-phase high-performance liquid chromatography can assess purity and separate related impurities. These methods are complementary rather than interchangeable.
Turbidity can indicate aggregation, precipitation, or microbial contamination. It may also result from incomplete dissolution or undissolved excipients. The cause is not identifiable from appearance alone.
Storage time depends on peptide sequence, concentration, solvent, and temperature. No single shelf life applies to all peptides. Stability should be determined by analytical testing for the specific preparation.